PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1671s0050.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 202aa    MW: 23493 Da    PI: 8.1986
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1671s0050.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.81.4e-46181501128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgy 82 
                             lp GfrF Pt+eel+++yL++k+eg++ e  +  i+++ iy++ePwdLpk     +++++++w+fF++r++++a+g r+nr+t+sgy
  SapurV1A.1671s0050.2.p  18 LPLGFRFYPTEEELISFYLHNKLEGERQERMQLvIPDISIYDIEPWDLPKlsgqLCQGDTEQWFFFAPRQEREARGGRPNRTTASGY 104
                             699***********************97665655***************656754455777************************** PP

                     NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             Wkatg+  +v+s++++++glkkt+vfy+g+ap+g+kt+W m+eyr+
  SapurV1A.1671s0050.2.p 105 WKATGSPGHVYSSDNRVIGLKKTMVFYTGKAPSGRKTKWKMNEYRA 150
                             ********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.68E-4814152IPR003441NAC domain
PROSITE profilePS5100545.97318172IPR003441NAC domain
PfamPF023652.4E-2419149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MLIQLRLSSE LDKKMEELPL GFRFYPTEEE LISFYLHNKL EGERQERMQL VIPDISIYDI  60
EPWDLPKLSG QLCQGDTEQW FFFAPRQERE ARGGRPNRTT ASGYWKATGS PGHVYSSDNR  120
VIGLKKTMVF YTGKAPSGRK TKWKMNEYRA IEVHELSNNA TPQVCMHMIF IFFLIKETNL  180
SIYRFPSLTI IWIQFLNAAE A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-341815220147NAC domain-containing protein 19
3swm_B4e-341815220147NAC domain-containing protein 19
3swm_C4e-341815220147NAC domain-containing protein 19
3swm_D4e-341815220147NAC domain-containing protein 19
3swp_A4e-341815220147NAC domain-containing protein 19
3swp_B4e-341815220147NAC domain-containing protein 19
3swp_C4e-341815220147NAC domain-containing protein 19
3swp_D4e-341815220147NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011006062.11e-103PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR35e-71NAC90_ARATH; NAC domain-containing protein 90
TrEMBLB9GI041e-103B9GI04_POPTR; NAC domain-containing protein 90
STRINGPOPTR_0001s22630.13e-99(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.13e-72NAC domain containing protein 90